Recombinant Human CFDP1 Protein, GST-Tagged
Cat.No. : | CFDP1-1166H |
Product Overview : | Human CFDP1 full-length ORF (NP_006315.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene. |
Molecular Mass : | 60 kDa |
AA Sequence : | MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens ] |
Official Symbol | CFDP1 |
Synonyms | CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR; |
Gene ID | 10428 |
mRNA Refseq | NM_006324 |
Protein Refseq | NP_006315 |
MIM | 608108 |
UniProt ID | Q9UEE9 |
◆ Recombinant Proteins | ||
CFDP1-3294HF | Recombinant Full Length Human CFDP1 Protein, GST-tagged | +Inquiry |
Cfdp1-2131M | Recombinant Mouse Cfdp1 Protein, Myc/DDK-tagged | +Inquiry |
CFDP1-3789H | Recombinant Human CFDP1 protein, His-tagged | +Inquiry |
CFDP1-1012R | Recombinant Rat CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFDP1-3345M | Recombinant Mouse CFDP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *