Recombinant Human CFDP1 Protein, GST-Tagged
| Cat.No. : | CFDP1-1166H | 
| Product Overview : | Human CFDP1 full-length ORF (NP_006315.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene. | 
| Molecular Mass : | 60 kDa | 
| AA Sequence : | MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens ] | 
| Official Symbol | CFDP1 | 
| Synonyms | CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR; | 
| Gene ID | 10428 | 
| mRNA Refseq | NM_006324 | 
| Protein Refseq | NP_006315 | 
| MIM | 608108 | 
| UniProt ID | Q9UEE9 | 
| ◆ Recombinant Proteins | ||
| CFDP1-3294HF | Recombinant Full Length Human CFDP1 Protein, GST-tagged | +Inquiry | 
| Cfdp1-2131M | Recombinant Mouse Cfdp1 Protein, Myc/DDK-tagged | +Inquiry | 
| CFDP1-3789H | Recombinant Human CFDP1 protein, His-tagged | +Inquiry | 
| CFDP1-1012R | Recombinant Rat CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CFDP1-3345M | Recombinant Mouse CFDP1 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            