Recombinant Human CFDP1 Protein, GST-Tagged
| Cat.No. : | CFDP1-1166H |
| Product Overview : | Human CFDP1 full-length ORF (NP_006315.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CFDP1 (Craniofacial Development Protein 1) is a Protein Coding gene. |
| Molecular Mass : | 60 kDa |
| AA Sequence : | MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens ] |
| Official Symbol | CFDP1 |
| Synonyms | CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR; |
| Gene ID | 10428 |
| mRNA Refseq | NM_006324 |
| Protein Refseq | NP_006315 |
| MIM | 608108 |
| UniProt ID | Q9UEE9 |
| ◆ Recombinant Proteins | ||
| CFDP1-1611M | Recombinant Mouse CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CFDP1-301301H | Recombinant Human CFDP1 protein, GST-tagged | +Inquiry |
| CFDP1-827R | Recombinant Rhesus monkey CFDP1 Protein, His-tagged | +Inquiry |
| CFDP1-3294HF | Recombinant Full Length Human CFDP1 Protein, GST-tagged | +Inquiry |
| CFDP1-1012R | Recombinant Rat CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *
