Recombinant Human CFL1 Protein, GST-Tagged

• Cat.No.: CFL1-1172H
• Product Overview: Human CFL1 full-length ORF (AAH11005, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]
• Molecular Mass: 44 kDa
• AA Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFL1 cofilin 1 (non-muscle) [ Homo sapiens ]
• Official Symbol: CFL1
• Synonyms: CFL1; cofilin 1 (non-muscle); CFL; cofilin-1; p18; 18 kDa phosphoprotein; cofilin, non-muscle isoform
• Gene ID: 1072
• mRNA Refseq: NM_005507
• Protein Refseq: NP_005498
• MIM: 601442
• UniProt ID: P23528