"CHAD" Related Products

Expand
Expand
Expand

Recombinant Human CHAD protein, T7/His-tagged

Cat.No.: CHAD-49H
Product Overview: Recombinant mature form of human CHAD gene cDNA (23 - 359aa, derived from BC036360) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFCPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAA NSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLL SPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKL RVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLE TLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro CHAD mediated chondrocytes differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CHAD protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As native (non-glycosilated) antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CHAD chondroadherin [ Homo sapiens ]
Official Symbol: CHAD
Synonyms: CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein;
Gene ID: 1101
mRNA Refseq: NM_001267
Protein Refseq: NP_001258
MIM: 602178
UniProt ID: O15335
Chromosome Location: 17q21.33
Pathway: ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function: extracellular matrix structural constituent;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.