Recombinant Human CHD8 Protein, GST-Tagged

Cat.No. : CHD8-1217H
Product Overview : Human CHD8 partial ORF (NP_065971, 1980 a.a. - 2078 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the chromodomain-helicase-DNA binding protein family, which is characterized by a SNF2-like domain and two chromatin organization modifier domains. The encoded protein also contains brahma and kismet domains, which are common to the subfamily of chromodomain-helicase-DNA binding proteins to which this protein belongs. This gene has been shown to function in several processes that include transcriptional regulation, epigenetic remodeling, promotion of cell proliferation, and regulation of RNA synthesis. Allelic variants of this gene are associated with autism spectrum disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2016]
Molecular Mass : 36.63 kDa
AA Sequence : EGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLAYM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHD8 chromodomain helicase DNA binding protein 8 [ Homo sapiens ]
Official Symbol CHD8
Synonyms CHD8; chromodomain helicase DNA binding protein 8; helicase with SNF2 domain 1, HELSNF1; chromodomain-helicase-DNA-binding protein 8; DUPLIN; KIAA1564; duplin; axis duplication inhibitor; ATP-dependent helicase CHD8; helicase with SNF2 domain 1; HELSNF1; DKFZp686N17164;
Gene ID 57680
mRNA Refseq NM_001170629
Protein Refseq NP_001164100
MIM 610528
UniProt ID Q9HCK8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHD8 Products

Required fields are marked with *

My Review for All CHD8 Products

Required fields are marked with *

0
cart-icon