Recombinant Human CHDH Protein, GST-Tagged
Cat.No. : | CHDH-1219H |
Product Overview : | Human CHDH full-length ORF (NP_060867.1, 1 a.a. - 594 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a choline dehydrogenase that localizes to the mitochondrion. Variations in this gene can affect susceptibility to choline deficiency. A few transcript variants have been found for this gene, but the full-length nature of only one has been characterized to date. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 91.8 kDa |
AA Sequence : | MWCLLRGLGRPGALARGALGQQQSLGARALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLLEAGPKDVRAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYVRGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAGYPLTEDMNGFQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKNGQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPITLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGSHIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPTIMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHDH choline dehydrogenase [ Homo sapiens ] |
Official Symbol | CHDH |
Synonyms | CHDH; choline dehydrogenase; choline dehydrogenase, mitochondrial; CDH; CHD; |
Gene ID | 55349 |
mRNA Refseq | NM_018397 |
Protein Refseq | NP_060867 |
UniProt ID | Q8NE62 |
◆ Recombinant Proteins | ||
CHDH-1219H | Recombinant Human CHDH Protein, GST-Tagged | +Inquiry |
CHDH-3187HF | Recombinant Full Length Human CHDH Protein, GST-tagged | +Inquiry |
CHDH-11168H | Recombinant Human CHDH, His-tagged | +Inquiry |
CHDH-3385M | Recombinant Mouse CHDH Protein | +Inquiry |
CHDH-1025R | Recombinant Rat CHDH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHDH-347HCL | Recombinant Human CHDH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHDH Products
Required fields are marked with *
My Review for All CHDH Products
Required fields are marked with *
0
Inquiry Basket