Recombinant Human CHGB protein(328-677aa), His-GST-tagged

• Cat.No.: CHGB-2911H
• Product Overview: Recombinant Human CHGB protein(P05060)(328-677aa), fused with N-terminal His and GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 328-677aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 73.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG

Gene Information

• Gene Name: CHGB chromogranin B (secretogranin 1) [ Homo sapiens ]
• Official Symbol: CHGB
• Synonyms: CHGB; chromogranin B (secretogranin 1); SCG1; secretogranin-1; secretogranin B; cgB; sgI; chromogranin-B; secretogranin I
• Gene ID: 1114
• mRNA Refseq: NM_001819
• Protein Refseq: NP_001810
• MIM: 118920
• UniProt ID: P05060