Recombinant Human CHIA Protein, GST-Tagged
Cat.No. : | CHIA-1234H |
Product Overview : | Human CHIA full-length ORF (NP_068569.2, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012] |
Molecular Mass : | 66.5 kDa |
AA Sequence : | MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHIA chitinase, acidic [ Homo sapiens ] |
Official Symbol | CHIA |
Synonyms | CHIA; chitinase, acidic; acidic mammalian chitinase; AMCase; CHIT2; TSA1902; lung-specific protein TSA1902; AMCASE; DKFZp313J1722; |
Gene ID | 27159 |
mRNA Refseq | NM_001040623 |
Protein Refseq | NP_001035713 |
MIM | 606080 |
UniProt ID | Q9BZP6 |
◆ Recombinant Proteins | ||
chiA-3689Z | Recombinant Zea mays chiA protein, His-tagged | +Inquiry |
CHIA-1371R | Recombinant Rat CHIA Protein | +Inquiry |
CHIA-5999C | Recombinant Chicken CHIA | +Inquiry |
CHIA-154C | Recombinant Cynomolgus Monkey CHIA Protein, His (Fc)-Avi-tagged | +Inquiry |
CHIA-4633H | Recombinant Human CHIA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHIA-7539HCL | Recombinant Human CHIA 293 Cell Lysate | +Inquiry |
CHIA-7538HCL | Recombinant Human CHIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIA Products
Required fields are marked with *
My Review for All CHIA Products
Required fields are marked with *