Recombinant Human CHRAC1 protein, GST-tagged

• Cat.No.: CHRAC1-301597H
• Product Overview: Recombinant Human CHRAC1 (1-131 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser131
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CHRAC1 chromatin accessibility complex 1 [ Homo sapiens ]
• Official Symbol: CHRAC1
• Synonyms: CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC15; histone fold protein CHRAC15; YCL1; histone-fold protein CHRAC15; DNA polymerase epsilon subunit p15; chromatin accessibility complex 15 kDa protein; CHARC1; CHARC15; CHRAC-1; CHRAC-15
• Gene ID: 54108
• mRNA Refseq: NM_017444
• Protein Refseq: NP_059140
• MIM: 607268
• UniProt ID: Q9NRG0