Recombinant Human CIAO1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CIAO1-5681H |
Product Overview : | CIAO1 MS Standard C13 and N15-labeled recombinant protein (NP_004795) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CIAO1 (Cytosolic Iron-Sulfur Assembly Component 1) is a Protein Coding gene. Diseases associated with CIAO1 include Progressive External Ophthalmoplegia With Mitochondrial Dna Deletions, Autosomal Dominant 6 and Xeroderma Pigmentosum, Variant Type. Among its related pathways are Glucose / Energy Metabolism and Metabolism. |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CIAO1 cytosolic iron-sulfur protein assembly 1 [ Homo sapiens (human) ] |
Official Symbol | CIAO1 |
Synonyms | CIAO1; cytosolic iron-sulfur protein assembly 1; cytosolic iron sulfur protein assembly 1 homolog (S. cerevisiae), WD repeat domain 39, WDR39; probable cytosolic iron-sulfur protein assembly protein CIAO1; CIA1; WD40 protein Ciao1; WD repeat domain 39; WD repeat-containing protein 39; cytosolic iron-sulfur protein assembly 1 homolog; WDR39; |
Gene ID | 9391 |
mRNA Refseq | NM_004804 |
Protein Refseq | NP_004795 |
MIM | 604333 |
UniProt ID | O76071 |
◆ Recombinant Proteins | ||
CIAO1-1068R | Recombinant Rat CIAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CIAO1-700R | Recombinant Rhesus Macaque CIAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CIAO1-10495Z | Recombinant Zebrafish CIAO1 | +Inquiry |
CIAO1-874R | Recombinant Rhesus monkey CIAO1 Protein, His-tagged | +Inquiry |
CIAO1-0616H | Recombinant Human CIAO1 Protein (M1-L339), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIAO1-7501HCL | Recombinant Human CIAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIAO1 Products
Required fields are marked with *
My Review for All CIAO1 Products
Required fields are marked with *