Recombinant Human CIAPIN1 Protein, GST-tagged

• Cat.No.: CIAPIN1-1354H
• Product Overview: Human CIAPIN1 full-length ORF ( NP_064709.2, 1 a.a. - 312 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 60 kDa
• AA Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CIAPIN1 cytokine induced apoptosis inhibitor 1 [ Homo sapiens ]
• Official Symbol: CIAPIN1
• Synonyms: CIAPIN1; cytokine induced apoptosis inhibitor 1; anamorsin; Anamorsin; predicted protein of HQ0915; cytokine-induced apoptosis inhibitor 1; fe-S cluster assembly protein DRE2 homolog; DRE2; PRO0915; 2810413N20Rik
• Gene ID: 57019
• mRNA Refseq: NM_020313
• Protein Refseq: NP_064709
• MIM: 608943
• UniProt ID: Q6FI81