Recombinant Human CINP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CINP-3672H
Product Overview : CINP MS Standard C13 and N15-labeled recombinant protein (NP_116019) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants.
Molecular Mass : 24.3 kDa
AA Sequence : MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CINP cyclin-dependent kinase 2 interacting protein [ Homo sapiens (human) ]
Official Symbol CINP
Synonyms CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein;
Gene ID 51550
mRNA Refseq NM_032630
Protein Refseq NP_116019
MIM 613362
UniProt ID Q9BW66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CINP Products

Required fields are marked with *

My Review for All CINP Products

Required fields are marked with *

0
cart-icon
0
compare icon