Recombinant Full Length Human CINP Protein, GST-tagged
Cat.No. : | CINP-1851HF |
Product Overview : | Human CINP full-length ORF ( AAH00600, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 212 amino acids |
Description : | The protein encoded by this gene is reported to be a component of the DNA replication complex as well as a genome-maintenance protein. It may interact with proteins important for replication initiation and has been shown to bind chromatin at the G1 phase of the cell cycle and dissociate from chromatin with replication initiation. It may also serve to regulate checkpoint signaling as part of the DNA damage response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 49.06 kDa |
AA Sequence : | MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CINP cyclin-dependent kinase 2 interacting protein [ Homo sapiens ] |
Official Symbol | CINP |
Synonyms | CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein |
Gene ID | 51550 |
mRNA Refseq | NM_032630 |
Protein Refseq | NP_116019 |
MIM | 613362 |
UniProt ID | Q9BW66 |
◆ Recombinant Proteins | ||
CINP-27247TH | Recombinant Human CINP, His-tagged | +Inquiry |
CINP-6732H | Recombinant Human CINP protein, GST-tagged | +Inquiry |
CINP-27249TH | Recombinant Human CINP | +Inquiry |
CINP-7986Z | Recombinant Zebrafish CINP | +Inquiry |
CINP-1694M | Recombinant Mouse CINP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CINP-7493HCL | Recombinant Human CINP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CINP Products
Required fields are marked with *
My Review for All CINP Products
Required fields are marked with *