Recombinant Human CLCA1 protein, His-tagged
| Cat.No. : | CLCA1-01H |
| Product Overview : | Recombinant Human CLCA1(a.a. 22-695) fused with His tag was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-695 a.a. |
| Description : | This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. |
| Form : | PBS buffer (pH 7.4). |
| AA Sequence : | NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKL ETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNN DEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSI VEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGN RLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVI RKKYPTDGSEIVLLTDGEDNTISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDA FGALSSGNGAVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDK NTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPI LRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSG |
| Purity : | > 95% determined by SDS-PAGE. |
| Storage : | For short term, storage it at +4 centigrade, For long term storage, prepare aliquots with 20% glycerol and store at -20 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.31 mg/ml |
| Gene Name | CLCA1 chloride channel accessory 1 [ Homo sapiens ] |
| Official Symbol | CLCA1 |
| Synonyms | CLCA1; chloride channel accessory 1; chloride channel regulator 1 , chloride channel, calcium activated, family member 1; calcium-activated chloride channel regulator 1; CaCC; CLCRG1; chloride channel regulator 1; calcium-dependent chloride channel-1; calcium-activated chloride channel protein 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; chloride channel, calcium activated, family member 1; CACC; GOB5; CACC1; CaCC-1; hCLCA1; hCaCC-1; FLJ95147; |
| Gene ID | 1179 |
| mRNA Refseq | NM_001285 |
| Protein Refseq | NP_001276 |
| MIM | 603906 |
| UniProt ID | A8K7I4 |
| Chromosome Location | 1p22.3 |
| Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; |
| Function | chloride channel activity; |
| ◆ Recombinant Proteins | ||
| CLCA1-11273H | Recombinant Human CLCA1, His-tagged | +Inquiry |
| CLCA1-2452H | Recombinant Human CLCA1 protein(741-890 aa), C-His-tagged | +Inquiry |
| CLCA1-888R | Recombinant Rhesus monkey CLCA1 Protein, His-tagged | +Inquiry |
| CLCA1-27070TH | Recombinant Human CLCA1 protein, GST-tagged | +Inquiry |
| CLCA1-10H | Recombinant Human CLCA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLCA1 Products
Required fields are marked with *
My Review for All CLCA1 Products
Required fields are marked with *
