Recombinant Human CLCA1 protein, His-tagged
Cat.No. : | CLCA1-01H |
Product Overview : | Recombinant Human CLCA1(a.a. 22-695) fused with His tag was expressed in E. coli. |
Availability | July 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-695 a.a. |
Description : | This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. |
Form : | PBS buffer (pH 7.4). |
AA Sequence : | NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKL ETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNN DEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSI VEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGN RLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVI RKKYPTDGSEIVLLTDGEDNTISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDA FGALSSGNGAVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDK NTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPI LRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSG |
Purity : | > 95% determined by SDS-PAGE. |
Storage : | For short term, storage it at +4 centigrade, For long term storage, prepare aliquots with 20% glycerol and store at -20 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.31 mg/ml |
Gene Name | CLCA1 chloride channel accessory 1 [ Homo sapiens ] |
Official Symbol | CLCA1 |
Synonyms | CLCA1; chloride channel accessory 1; chloride channel regulator 1 , chloride channel, calcium activated, family member 1; calcium-activated chloride channel regulator 1; CaCC; CLCRG1; chloride channel regulator 1; calcium-dependent chloride channel-1; calcium-activated chloride channel protein 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; chloride channel, calcium activated, family member 1; CACC; GOB5; CACC1; CaCC-1; hCLCA1; hCaCC-1; FLJ95147; |
Gene ID | 1179 |
mRNA Refseq | NM_001285 |
Protein Refseq | NP_001276 |
MIM | 603906 |
UniProt ID | A8K7I4 |
Chromosome Location | 1p22.3 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; |
Function | chloride channel activity; |
◆ Recombinant Proteins | ||
CLCA1-08H | Recombinant Human CLCA1 Protein, His-tagged | +Inquiry |
CLCA1-27070TH | Recombinant Human CLCA1 protein, GST-tagged | +Inquiry |
CLCA1-4909P | Recombinant Pig CLCA1 protein, His&Myc-tagged | +Inquiry |
CLCA1-10H | Recombinant Human CLCA1 protein, His-tagged | +Inquiry |
CLCA1-714R | Recombinant Rhesus Macaque CLCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLCA1 Products
Required fields are marked with *
My Review for All CLCA1 Products
Required fields are marked with *