Recombinant Human CLCA1 protein, His-tagged

Cat.No. : CLCA1-01H
Product Overview : Recombinant Human CLCA1(a.a. 22-695) fused with His tag was expressed in E. coli.
Availability July 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 22-695 a.a.
Description : This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
Form : PBS buffer (pH 7.4).
AA Sequence : NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKL ETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNN DEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSI VEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGN RLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVI RKKYPTDGSEIVLLTDGEDNTISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDA FGALSSGNGAVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDK NTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPI LRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSG
Purity : > 95% determined by SDS-PAGE.
Storage : For short term, storage it at +4 centigrade, For long term storage, prepare aliquots with 20% glycerol and store at -20 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.31 mg/ml
Gene Name CLCA1 chloride channel accessory 1 [ Homo sapiens ]
Official Symbol CLCA1
Synonyms CLCA1; chloride channel accessory 1; chloride channel regulator 1 , chloride channel, calcium activated, family member 1; calcium-activated chloride channel regulator 1; CaCC; CLCRG1; chloride channel regulator 1; calcium-dependent chloride channel-1; calcium-activated chloride channel protein 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; chloride channel, calcium activated, family member 1; CACC; GOB5; CACC1; CaCC-1; hCLCA1; hCaCC-1; FLJ95147;
Gene ID 1179
mRNA Refseq NM_001285
Protein Refseq NP_001276
MIM 603906
UniProt ID A8K7I4
Chromosome Location 1p22.3
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem;
Function chloride channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLCA1 Products

Required fields are marked with *

My Review for All CLCA1 Products

Required fields are marked with *

0
cart-icon