Recombinant Human CLCA1 protein, GST-tagged
Cat.No. : | CLCA1-27070TH |
Product Overview : | Recombinant Human CLCA1(677 a.a. - 776 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 677-776 a.a. |
Description : | This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLF PPGQITDLKAEIHGGSLINLTWTAP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CLCA1 chloride channel accessory 1 [ Homo sapiens ] |
Official Symbol | CLCA1 |
Synonyms | CLCA1; chloride channel accessory 1; chloride channel regulator 1 , chloride channel, calcium activated, family member 1; calcium-activated chloride channel regulator 1; CaCC; CLCRG1; chloride channel regulator 1; calcium-dependent chloride channel-1; calcium-activated chloride channel protein 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; chloride channel, calcium activated, family member 1; CACC; GOB5; CACC1; CaCC-1; hCLCA1; hCaCC-1; FLJ95147; |
Gene ID | 1179 |
mRNA Refseq | NM_001285 |
Protein Refseq | NP_001276 |
MIM | 603906 |
UniProt ID | A8K7I4 |
Chromosome Location | 1p22.3 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; |
Function | chloride channel activity; |
◆ Recombinant Proteins | ||
CLCA1-714R | Recombinant Rhesus Macaque CLCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLCA1-08H | Recombinant Human CLCA1 Protein, His-tagged | +Inquiry |
CLCA1-27070TH | Recombinant Human CLCA1 protein, GST-tagged | +Inquiry |
CLCA1-01H | Recombinant Human CLCA1 protein, His-tagged | +Inquiry |
CLCA1-11273H | Recombinant Human CLCA1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLCA1 Products
Required fields are marked with *
My Review for All CLCA1 Products
Required fields are marked with *