Recombinant Human CLCA2 protein, His-tagged
| Cat.No. : | CLCA2-19H |
| Product Overview : | Recombinant Human CLCA2 protein(Q9UQC9)(771-850 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 771-850 aa |
| Form : | Phosphate buffered saline |
| AASequence : | DLEAVKVEEELTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFSPQISTNGPEH |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.2-1.0 mg/mL. |
| Gene Name | CLCA2 chloride channel accessory 2 [ Homo sapiens ] |
| Official Symbol | CLCA2 |
| Synonyms | CLCA2; chloride channel accessory 2; chloride channel regulator 2 , chloride channel, calcium activated, family member 2; calcium-activated chloride channel regulator 2; CLCRG2; hCLCA2; hCaCC-3; chloride channel regulator 2; calcium-activated chloride channel-2; calcium-activated chloride channel protein 3; CLCA family member 2, chloride channel regulator; calcium-activated chloride channel family member 2; chloride channel, calcium activated, family member 2; CACC; CACC3; CaCC-3; FLJ97885; |
| Gene ID | 9635 |
| mRNA Refseq | NM_006536 |
| Protein Refseq | NP_006527 |
| MIM | 604003 |
| UniProt ID | Q9UQC9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLCA2 Products
Required fields are marked with *
My Review for All CLCA2 Products
Required fields are marked with *



