Recombinant Human CLCA2 protein, His-tagged

Cat.No. : CLCA2-19H
Product Overview : Recombinant Human CLCA2 protein(Q9UQC9)(771-850 aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 771-850 aa
Form : Phosphate buffered saline
AASequence : DLEAVKVEEELTLSWTAPGEDFDQGQATSYEIRMSKSLQNIQDDFNNAILVNTSKRNPQQAGIREIFTFSPQISTNGPEH
Storage : Store at -20°C to -80°C.
Concentration : 0.2-1.0 mg/mL.
Gene Name CLCA2 chloride channel accessory 2 [ Homo sapiens ]
Official Symbol CLCA2
Synonyms CLCA2; chloride channel accessory 2; chloride channel regulator 2 , chloride channel, calcium activated, family member 2; calcium-activated chloride channel regulator 2; CLCRG2; hCLCA2; hCaCC-3; chloride channel regulator 2; calcium-activated chloride channel-2; calcium-activated chloride channel protein 3; CLCA family member 2, chloride channel regulator; calcium-activated chloride channel family member 2; chloride channel, calcium activated, family member 2; CACC; CACC3; CaCC-3; FLJ97885;
Gene ID 9635
mRNA Refseq NM_006536
Protein Refseq NP_006527
MIM 604003
UniProt ID Q9UQC9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLCA2 Products

Required fields are marked with *

My Review for All CLCA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon