Recombinant Human CLEC3B Protein, GST-tagged

• Cat.No.: CLEC3B-1466H
• Product Overview: Human CLEC3B full-length ORF ( AAH11024, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CLEC3B (C-Type Lectin Domain Family 3 Member B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include calcium ion binding and heparin binding. An important paralog of this gene is CLEC3A.
• Molecular Mass: 47.96 kDa
• AA Sequence: MEVWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNGMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC3B C-type lectin domain family 3, member B [ Homo sapiens ]
• Official Symbol: CLEC3B
• Synonyms: CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246
• Gene ID: 7123
• mRNA Refseq: NM_003278
• Protein Refseq: NP_003269
• MIM: 187520
• UniProt ID: P05452