Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Description : |
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. |
Form : |
Supplied as a 0.2 µM filtered solution of 10mM Tris, 0.1%Triton100, pH 8.0 |
Molecular Mass : |
27.7kD |
AA Sequence : |
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPRLEHHHHHH* |
Endotoxin : |
Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : |
>95% as determined by SDS-PAGE and Coomassie blue staining |