Recombinant Human CLIC3 Protein, His-tagged
| Cat.No. : | CLIC3-533H |
| Product Overview : | Recombinant Human CLIC3 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. |
| Form : | Supplied as a 0.2 µM filtered solution of 10mM Tris, 0.1%Triton100, pH 8.0 |
| Molecular Mass : | 27.7kD |
| AA Sequence : | MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPRLEHHHHHH* |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | CLIC3 chloride intracellular channel 3 [ Homo sapiens ] |
| Official Symbol | CLIC3 |
| Synonyms | CLIC3; chloride intracellular channel 3; chloride intracellular channel protein 3; |
| Gene ID | 9022 |
| mRNA Refseq | NM_004669 |
| Protein Refseq | NP_004660 |
| MIM | 606533 |
| UniProt ID | O95833 |
| ◆ Recombinant Proteins | ||
| Clic3-2189M | Recombinant Mouse Clic3 Protein, Myc/DDK-tagged | +Inquiry |
| CLIC3-3259H | Recombinant Human CLIC3 Protein, MYC/DDK-tagged | +Inquiry |
| CLIC3-2182HF | Recombinant Full Length Human CLIC3 Protein, GST-tagged | +Inquiry |
| CLIC3-1532H | Recombinant Human Chloride Intracellular Channel 3, T7-tagged | +Inquiry |
| CLIC3-2265H | Recombinant Human CLIC3 Protein (Met1-Arg236), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLIC3-364HCL | Recombinant Human CLIC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC3 Products
Required fields are marked with *
My Review for All CLIC3 Products
Required fields are marked with *
