Recombinant Human CNGB3 protein, His-tagged
| Cat.No. : | CNGB3-2604H |
| Product Overview : | Recombinant Human CNGB3 protein(1-216 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-216 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MFKSLTKVKKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQEENKGEEKSLKTKSTPVTSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPAAPVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CNGB3 cyclic nucleotide gated channel beta 3 [ Homo sapiens ] |
| Official Symbol | CNGB3 |
| Synonyms | CNGB3; cyclic nucleotide gated channel beta 3; ACHM3, achromatopsia (rod monochromacy) 3; cyclic nucleotide-gated cation channel beta-3; CNG channel beta-3; cone photoreceptor cGMP-gated cation channel beta-subunit; cyclic nucleotide-gated cation channel modulatory subunit; |
| Gene ID | 54714 |
| mRNA Refseq | NM_019098 |
| Protein Refseq | NP_061971 |
| MIM | 605080 |
| UniProt ID | Q9NQW8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNGB3 Products
Required fields are marked with *
My Review for All CNGB3 Products
Required fields are marked with *



