Recombinant Human CNOT2 Protein, GST-tagged
Cat.No. : | CNOT2-1578H |
Product Overview : | Human CNOT2 full-length ORF ( AAH02597, 1 a.a. - 540 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the multi-component CCR4-NOT complex. The CCR4-NOT complex regulates mRNA synthesis and degradation and is also thought to be involved in mRNA splicing, transport and localization. The encoded protein interacts with histone deacetylases and functions as a repressor of polymerase II transcription. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 85.14 kDa |
AA Sequence : | MVRTDGHTLSEKRNYQVTNSMFGASRKKFVEGVDSDYHDENMYYSQSSMFPHRSEKDMLASPSTSGQLSQFGASLYGQQSALGLPMRGMSNNTPQLNRSLSQGTQLPSHVTPTTGVPTMSLHTPPSPSRGILPMNPRNMMNHSQVGQGIGIPSRTNSMSSSGLGSPNRSSPSIICMPKQQPSRQPFTVNSMSGFGMNRNQAFGMNNSLSSNIFNGTDGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQVLPDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNOT2 CCR4-NOT transcription complex, subunit 2 [ Homo sapiens ] |
Official Symbol | CNOT2 |
Synonyms | CNOT2; CCR4-NOT transcription complex, subunit 2; NOT2; CCR4-NOT transcription complex subunit 2; CDC36; NOT2H; CCR4-associated factor 2; negative regulator of transcription 2; HSPC131; FLJ26456; |
Gene ID | 4848 |
mRNA Refseq | NM_001199302 |
Protein Refseq | NP_001186231 |
MIM | 604909 |
UniProt ID | Q9NZN8 |
◆ Recombinant Proteins | ||
CNOT2-763R | Recombinant Rhesus Macaque CNOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CNOT2-938R | Recombinant Rhesus monkey CNOT2 Protein, His-tagged | +Inquiry |
CNOT2-3665M | Recombinant Mouse CNOT2 Protein | +Inquiry |
CNOT2-1936HF | Recombinant Full Length Human CNOT2 Protein, GST-tagged | +Inquiry |
CNOT2-2036C | Recombinant Chicken CNOT2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT2-7403HCL | Recombinant Human CNOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT2 Products
Required fields are marked with *
My Review for All CNOT2 Products
Required fields are marked with *