Recombinant Human CNPY1 Protein, GST-tagged
| Cat.No. : | CNPY1-1592H |
| Product Overview : | Human CNPY1 full-length ORF (1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cnpy1 is expressed in the midbrain-hindbrain (MHB) boundary in zebrafish, binds FGFR1 (MIM 136350), and plays a role in FGF signaling (Hirate and Okamoto, 2006 [PubMed 16488878]).[supplied by OMIM, Dec 2008] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANHTEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNPY1 canopy 1 homolog (zebrafish) [ Homo sapiens ] |
| Official Symbol | CNPY1 |
| Synonyms | CNPY1; canopy 1 homolog (zebrafish); Canopy FGF Signaling Regulator 1; Canopy 1 Homolog (Zebrafish) |
| Gene ID | 285888 |
| mRNA Refseq | NM_001103176.1 |
| Protein Refseq | NP_001096646.1 |
| MIM | 612493 |
| UniProt ID | Q3B7I2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNPY1 Products
Required fields are marked with *
My Review for All CNPY1 Products
Required fields are marked with *




