Recombinant Human COIL protein(131-240 aa), C-His-tagged
Cat.No. : | COIL-2746H |
Product Overview : | Recombinant Human COIL protein(P38432)(131-240 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131-240 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCS |
Gene Name | COIL coilin [ Homo sapiens ] |
Official Symbol | COIL |
Synonyms | COIL; coilin; CLN80; p80 coilin; p80; coilin p80; p80-coilin; |
Gene ID | 8161 |
mRNA Refseq | NM_004645 |
Protein Refseq | NP_004636 |
MIM | 600272 |
UniProt ID | P38432 |
◆ Recombinant Proteins | ||
COIL-2717H | Recombinant Human COIL protein, His & T7-tagged | +Inquiry |
COIL-2086HF | Recombinant Full Length Human COIL Protein, GST-tagged | +Inquiry |
COIL-958R | Recombinant Rhesus monkey COIL Protein, His-tagged | +Inquiry |
COIL-9061Z | Recombinant Zebrafish COIL | +Inquiry |
COIL-783R | Recombinant Rhesus Macaque COIL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COIL-7380HCL | Recombinant Human COIL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COIL Products
Required fields are marked with *
My Review for All COIL Products
Required fields are marked with *
0
Inquiry Basket