Recombinant Human COIL protein(131-240 aa), C-His-tagged

• Cat.No.: COIL-2746H
• Product Overview: Recombinant Human COIL protein(P38432)(131-240 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 131-240 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCS

Gene Information

• Gene Name: COIL coilin [ Homo sapiens ]
• Official Symbol: COIL
• Synonyms: COIL; coilin; CLN80; p80 coilin; p80; coilin p80; p80-coilin
• Gene ID: 8161
• mRNA Refseq: NM_004645
• Protein Refseq: NP_004636
• MIM: 600272
• UniProt ID: P38432