Recombinant Human COIL
Cat.No. : | COIL-26172TH |
Product Overview : | Recombinant fragment of Human Coilin with a proprietary tag: predicted molecular weight 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14. |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Found in all the cell types examined. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | IAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEP |
Sequence Similarities : | Belongs to the coilin family. |
Gene Name | COIL coilin [ Homo sapiens ] |
Official Symbol | COIL |
Synonyms | COIL; coilin; CLN80; p80 coilin; |
Gene ID | 8161 |
mRNA Refseq | NM_004645 |
Protein Refseq | NP_004636 |
MIM | 600272 |
Uniprot ID | P38432 |
Chromosome Location | 17q22-q23 |
Function | disulfide oxidoreductase activity; identical protein binding; protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
COIL-2717H | Recombinant Human COIL protein, His & T7-tagged | +Inquiry |
COIL-2746H | Recombinant Human COIL protein(131-240 aa), C-His-tagged | +Inquiry |
COIL-958R | Recombinant Rhesus monkey COIL Protein, His-tagged | +Inquiry |
COIL-1633H | Recombinant Human COIL Protein, GST-tagged | +Inquiry |
COIL-2086HF | Recombinant Full Length Human COIL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COIL-7380HCL | Recombinant Human COIL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COIL Products
Required fields are marked with *
My Review for All COIL Products
Required fields are marked with *