Recombinant Human COL10A1, His-tagged
Cat.No. : | COL10A1-85H |
Product Overview : | A DNA sequence encoding human COL10A1 corresponding to amino acid (19-680) was expressed with an N-terminal polyhistidine tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 19-680 a.a. |
Description : | This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD). |
Form : | Liquid. PBS pH7.4 |
AA Sequence : | VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGE PGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPG PRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEM GPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGG PGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGK PGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGD PGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSAN QGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNG TPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Store it at +4°C for short term (5 weeks). For long term storage (12 months), store it at -20? - -70°C. Avoid freeze-thaw cycles. |
Gene Name | COL10A1 collagen, type X, alpha 1 [ Homo sapiens (human) ] |
Official Symbol | COL10A1 |
Synonyms | COL10A1; collagen, type X, alpha 1; collagen alpha-1(X) chain; Schmid metaphyseal chondrodysplasia; COAA1_HUMAN; Col10a 1; COL10A1; Collagen alpha 1(X) chain; Collagen alpha-1(X) chain; Collagen type X alpha 1 (Schmid metaphyseal chondrodysplasia); Collagen type X alpha 1; Collagen X alpha 1 polypeptide; CollagenX; fa66d11; fb10c08; OTTHUMP00000040411; Procollagen type X alpha 1; Schmid metaphyseal chondrodysplasia; wu:fa66d11; wu:fb10c08; collagen X, alpha-1 polypeptide |
Gene ID | 1300 |
mRNA Refseq | NM_000493 |
Protein Refseq | NP_000484 |
MIM | 120110 |
UniProt ID | Q03692 |
Chromosome Location | 6q21-q22 |
Pathway | Assembly of c; ollagen fibrils and other multimeric structures; Collagen biosynthesis and modifying enzymes; Endochondral Ossification |
Function | metal ion binding |
◆ Recombinant Proteins | ||
COL10A1-959R | Recombinant Rhesus monkey COL10A1 Protein, His-tagged | +Inquiry |
COL10A1-3829H | Recombinant Human COL10A1 protein, His-tagged | +Inquiry |
COL10A1-784R | Recombinant Rhesus Macaque COL10A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL10A1-1773H | Recombinant Human COL10A1 Protein (Thr547-Met680), His tagged | +Inquiry |
COL10A1-85H | Recombinant Human COL10A1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL10A1 Products
Required fields are marked with *
My Review for All COL10A1 Products
Required fields are marked with *