Recombinant Human COL10A1 protein, His-tagged
Cat.No. : | COL10A1-3829H |
Product Overview : | Recombinant Human COL10A1 protein(157-412 aa), fused to His tag, was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 157-412 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COL10A1 collagen, type X, alpha 1 [ Homo sapiens ] |
Official Symbol | COL10A1 |
Synonyms | COL10A1; collagen, type X, alpha 1; collagen alpha-1(X) chain; Schmid metaphyseal chondrodysplasia; collagen X, alpha-1 polypeptide; |
Gene ID | 1300 |
mRNA Refseq | NM_000493 |
Protein Refseq | NP_000484 |
MIM | 120110 |
UniProt ID | Q03692 |
◆ Recombinant Proteins | ||
COL10A1-88H | Recombinant Human COL10A1, MYC/DDK-tagged | +Inquiry |
Col10a1-915M | Recombinant Mouse Col10a1 Protein, MYC/DDK-tagged | +Inquiry |
Col10a1-350M | Recombinant Mouse Col10a1 Protein, His-tagged | +Inquiry |
COL10A1-4344HFL | Recombinant Full Length Human COL10A1, Flag-tagged | +Inquiry |
COL10A1-3713M | Recombinant Mouse COL10A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL10A1 Products
Required fields are marked with *
My Review for All COL10A1 Products
Required fields are marked with *
0
Inquiry Basket