Recombinant Human COL10A1 protein, His-tagged

Cat.No. : COL10A1-3829H
Product Overview : Recombinant Human COL10A1 protein(157-412 aa), fused to His tag, was expressed in E. coli.
Availability January 09, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 157-412 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : KPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name COL10A1 collagen, type X, alpha 1 [ Homo sapiens ]
Official Symbol COL10A1
Synonyms COL10A1; collagen, type X, alpha 1; collagen alpha-1(X) chain; Schmid metaphyseal chondrodysplasia; collagen X, alpha-1 polypeptide;
Gene ID 1300
mRNA Refseq NM_000493
Protein Refseq NP_000484
MIM 120110
UniProt ID Q03692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL10A1 Products

Required fields are marked with *

My Review for All COL10A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon