Recombinant Human COLQ protein, His-tagged
| Cat.No. : | COLQ-15H |
| Product Overview : | Recombinant Human COLQ protein(Q9Y215)(301-420 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 301-420 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 15 kDa |
| AASequence : | NPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGS |
| Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.2-1.0 mg/mL. |
| Gene Name | COLQ collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase [ Homo sapiens ] |
| Official Symbol | COLQ |
| Synonyms | COLQ; collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase; acetylcholinesterase collagenic tail peptide; acetylcholinesterase associated collagen; AChE Q subunit; collagenic tail of endplate acetylcholinesterase; EAD; single strand of homotrimeric collagen like tail subunit of asymmetric acetylcholinesterase; acetylcholinesterase-associated collagen; single strand of homotrimeric collagen-like tail subunit of asymmetric acetylcholinesterase; FLJ55041; |
| Gene ID | 8292 |
| mRNA Refseq | NM_005677 |
| Protein Refseq | NP_005668 |
| MIM | 603033 |
| UniProt ID | Q9Y215 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COLQ Products
Required fields are marked with *
My Review for All COLQ Products
Required fields are marked with *
Recently Viewed
