Recombinant Human COPZ1, His-tagged
Cat.No. : | COPZ1-26340TH |
Product Overview : | Recombinant full length Human COPZ1 with an N terminal His tag; 197 amino acids, predicted MWt 22.3kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 177 amino acids |
Description : | The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. |
Conjugation : | HIS |
Molecular Weight : | 22.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR |
Sequence Similarities : | Belongs to the adaptor complexes small subunit family. |
Gene Name | COPZ1 coatomer protein complex, subunit zeta 1 [ Homo sapiens ] |
Official Symbol | COPZ1 |
Synonyms | COPZ1; coatomer protein complex, subunit zeta 1; coatomer protein complex, subunit zeta , COPZ; coatomer subunit zeta-1; CGI 120; |
Gene ID | 22818 |
mRNA Refseq | NM_016057 |
Protein Refseq | NP_057141 |
Uniprot ID | P61923 |
Chromosome Location | 12q13.2-q13.3 |
Pathway | COPI Mediated Transport, organism-specific biosystem; Golgi to ER Retrograde Transport, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
◆ Recombinant Proteins | ||
COPZ1-1711H | Recombinant Human COPZ1 Protein, GST-tagged | +Inquiry |
COPZ1-26340TH | Recombinant Human COPZ1, His-tagged | +Inquiry |
COPZ1-1971HF | Recombinant Full Length Human COPZ1 Protein, GST-tagged | +Inquiry |
COPZ1-727H | Recombinant Human COPZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COPZ1-9057Z | Recombinant Zebrafish COPZ1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPZ1-7351HCL | Recombinant Human COPZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPZ1 Products
Required fields are marked with *
My Review for All COPZ1 Products
Required fields are marked with *
0
Inquiry Basket