Recombinant Human COPZ1, His-tagged

Cat.No. : COPZ1-26340TH
Product Overview : Recombinant full length Human COPZ1 with an N terminal His tag; 197 amino acids, predicted MWt 22.3kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 177 amino acids
Description : The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
Conjugation : HIS
Molecular Weight : 22.300kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
Sequence Similarities : Belongs to the adaptor complexes small subunit family.
Gene Name COPZ1 coatomer protein complex, subunit zeta 1 [ Homo sapiens ]
Official Symbol COPZ1
Synonyms COPZ1; coatomer protein complex, subunit zeta 1; coatomer protein complex, subunit zeta , COPZ; coatomer subunit zeta-1; CGI 120;
Gene ID 22818
mRNA Refseq NM_016057
Protein Refseq NP_057141
Uniprot ID P61923
Chromosome Location 12q13.2-q13.3
Pathway COPI Mediated Transport, organism-specific biosystem; Golgi to ER Retrograde Transport, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPZ1 Products

Required fields are marked with *

My Review for All COPZ1 Products

Required fields are marked with *

0
cart-icon