Recombinant Human COPZ1 Protein, GST-tagged
Cat.No. : | COPZ1-1711H |
Product Overview : | Human COPZ1 full-length ORF ( NP_057141.1, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein complex (COP)I-vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012] |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COPZ1 CGI-120 protein [ Homo sapiens ] |
Official Symbol | COPZ1 |
Synonyms | COPZ1; CGI-120 protein; |
Gene ID | 22818 |
mRNA Refseq | NM_001271734 |
Protein Refseq | NP_001258663 |
MIM | 615472 |
UniProt ID | P61923 |
◆ Recombinant Proteins | ||
COPZ1-3787M | Recombinant Mouse COPZ1 Protein | +Inquiry |
COPZ1-1894M | Recombinant Mouse COPZ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPZ1-26340TH | Recombinant Human COPZ1, His-tagged | +Inquiry |
COPZ1-1971HF | Recombinant Full Length Human COPZ1 Protein, GST-tagged | +Inquiry |
Copz1-2266M | Recombinant Mouse Copz1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPZ1-7351HCL | Recombinant Human COPZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPZ1 Products
Required fields are marked with *
My Review for All COPZ1 Products
Required fields are marked with *