Recombinant Human CPLX2 Protein, GST-tagged
| Cat.No. : | CPLX2-1786H |
| Product Overview : | Human CPLX2 full-length ORF ( ADR82826.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 14.8 kDa |
| AA Sequence : | MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CPLX2 complexin 2 [ Homo sapiens ] |
| Official Symbol | CPLX2 |
| Synonyms | CPLX2; complexin 2; complexin-2; CPX 2; DKFZp547D155; CPX II; synaphin 1; synaphin-1; complexin II; CPX2; Hfb1; 921-L; CPX-2; MGC138492; |
| Gene ID | 10814 |
| mRNA Refseq | NM_001008220 |
| Protein Refseq | NP_001008221 |
| MIM | 605033 |
| UniProt ID | Q6PUV4 |
| ◆ Recombinant Proteins | ||
| CPLX2-1004R | Recombinant Rhesus monkey CPLX2 Protein, His-tagged | +Inquiry |
| CPLX2-5683H | Recombinant Human CPLX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CPLX2-1108H | Recombinant Human CPLX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CPLX2-572H | Recombinant Human CPLX2 Protein, DDK-tagged | +Inquiry |
| CPLX2-1567R | Recombinant Rat CPLX2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPLX2-7312HCL | Recombinant Human CPLX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPLX2 Products
Required fields are marked with *
My Review for All CPLX2 Products
Required fields are marked with *
