Recombinant Human CPLX2 Protein, GST-tagged

Cat.No. : CPLX2-1786H
Product Overview : Human CPLX2 full-length ORF ( ADR82826.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 14.8 kDa
AA Sequence : MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CPLX2 complexin 2 [ Homo sapiens ]
Official Symbol CPLX2
Synonyms CPLX2; complexin 2; complexin-2; CPX 2; DKFZp547D155; CPX II; synaphin 1; synaphin-1; complexin II; CPX2; Hfb1; 921-L; CPX-2; MGC138492;
Gene ID 10814
mRNA Refseq NM_001008220
Protein Refseq NP_001008221
MIM 605033
UniProt ID Q6PUV4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPLX2 Products

Required fields are marked with *

My Review for All CPLX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon