Recombinant Human CPLX2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CPLX2-1108H |
Product Overview : | CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_001008221) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CPLX2 complexin 2 [ Homo sapiens (human) ] |
Official Symbol | CPLX2 |
Synonyms | CPLX2; complexin 2; complexin-2; CPX 2; DKFZp547D155; CPX II; synaphin 1; synaphin-1; complexin II; CPX2; Hfb1; 921-L; CPX-2; MGC138492; |
Gene ID | 10814 |
mRNA Refseq | NM_001008220 |
Protein Refseq | NP_001008221 |
MIM | 605033 |
UniProt ID | Q6PUV4 |
◆ Recombinant Proteins | ||
CPLX2-7849Z | Recombinant Zebrafish CPLX2 | +Inquiry |
CPLX2-3941H | Recombinant Human CPLX2 protein(Asp2-Lys134), His-tagged | +Inquiry |
Cplx2-1441M | Recombinant Mouse Cplx2 protein, His-tagged | +Inquiry |
CPLX2-829R | Recombinant Rhesus Macaque CPLX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPLX2-1224R | Recombinant Rat CPLX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPLX2-7312HCL | Recombinant Human CPLX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPLX2 Products
Required fields are marked with *
My Review for All CPLX2 Products
Required fields are marked with *