Recombinant Human CRBN protein, GST-tagged
| Cat.No. : | CRBN-13H |
| Product Overview : | Recombinant Human CRBN(1 a.a. - 442 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-442 a.a. |
| Description : | This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutations in this gene are associated with autosomal recessive nonsyndromic mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 76.9 kDa |
| AA Sequence : | MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDD DSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDF GIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQ KYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLK IGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPS TEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CRBN cereblon [ Homo sapiens ] |
| Official Symbol | CRBN |
| Synonyms | CRBN; cereblon; mental retardation, non syndromic, autosomal recessive, 2A , MRT2A; protein cereblon; protein x 0001; MRT2; MRT2A; MGC27358; DKFZp781K0715; |
| Gene ID | 51185 |
| mRNA Refseq | NM_016302 |
| Protein Refseq | NP_057386 |
| MIM | 609262 |
| UniProt ID | Q96SW2 |
| Chromosome Location | 3p26.3 |
| Function | ATP-dependent peptidase activity; protein binding; |
| ◆ Recombinant Proteins | ||
| CRBN-1195Z | Recombinant Zebrafish CRBN | +Inquiry |
| CRBN-2109M | Recombinant Mouse CRBN Protein (1-445 aa), His-Myc-tagged | +Inquiry |
| CRBN-DBB1-25HFL | Recombinant Full Length Human CRBN/DDB1 Protein, FLAG tagged | +Inquiry |
| CRBN-1962M | Recombinant Mouse CRBN Protein, His (Fc)-Avi-tagged | +Inquiry |
| Crbn-6854R | Recombinant Rat Crbn protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CRBN-657H | Recombinant Human CRBN Protein, His&Avi tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRBN-395HCL | Recombinant Human CRBN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRBN Products
Required fields are marked with *
My Review for All CRBN Products
Required fields are marked with *
