Recombinant Human CRBN protein, GST-tagged
Cat.No. : | CRBN-13H |
Product Overview : | Recombinant Human CRBN(1 a.a. - 442 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-442 a.a. |
Description : | This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutations in this gene are associated with autosomal recessive nonsyndromic mental retardation. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 76.9 kDa |
AA Sequence : | MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDD DSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDF GIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQ KYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLK IGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPS TEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CRBN cereblon [ Homo sapiens ] |
Official Symbol | CRBN |
Synonyms | CRBN; cereblon; mental retardation, non syndromic, autosomal recessive, 2A , MRT2A; protein cereblon; protein x 0001; MRT2; MRT2A; MGC27358; DKFZp781K0715; |
Gene ID | 51185 |
mRNA Refseq | NM_016302 |
Protein Refseq | NP_057386 |
MIM | 609262 |
UniProt ID | Q96SW2 |
Chromosome Location | 3p26.3 |
Function | ATP-dependent peptidase activity; protein binding; |
◆ Recombinant Proteins | ||
CRBN-13HFL | Recombinant Full Length Human CRBN Protein, N-Flag-tagged | +Inquiry |
CRBN-2792H | Recombinant Human CRBN Full Length Transmembrane protein, His-tagged | +Inquiry |
CRBN-1243R | Recombinant Rat CRBN Protein, His (Fc)-Avi-tagged | +Inquiry |
CRBN-02H | Recombinant Human Cereblon/DDB1/Cul4A/Rbx1 Complex Protein, His-tagged | +Inquiry |
CRBN-663HF | Recombinant Full Length Human CRBN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRBN-395HCL | Recombinant Human CRBN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRBN Products
Required fields are marked with *
My Review for All CRBN Products
Required fields are marked with *
0
Inquiry Basket