Recombinant Human CRCP Protein, His-tagged
Cat.No. : | CRCP-1838H |
Product Overview : | Human CRCP (NP_055293, 1 a.a. - 148 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Molecular Mass : | 19.0 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol) |
Gene Name | CRCP CGRP receptor component [ Homo sapiens ] |
Official Symbol | CRCP |
Synonyms | CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194; |
Gene ID | 27297 |
mRNA Refseq | NM_001040647 |
Protein Refseq | NP_001035737 |
MIM | 606121 |
UniProt ID | O75575 |
◆ Recombinant Proteins | ||
Crcp-2306M | Recombinant Mouse Crcp Protein, Myc/DDK-tagged | +Inquiry |
CRCP-3633H | Recombinant Human CRCP, His-tagged | +Inquiry |
CRCP-1244R | Recombinant Rat CRCP Protein, His (Fc)-Avi-tagged | +Inquiry |
CRCP-1838H | Recombinant Human CRCP Protein, His-tagged | +Inquiry |
CRCP-4225H | Recombinant Human CRCP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRCP-7291HCL | Recombinant Human CRCP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRCP Products
Required fields are marked with *
My Review for All CRCP Products
Required fields are marked with *
0
Inquiry Basket