Recombinant Human CRCP Protein, His-tagged

Cat.No. : CRCP-1838H
Product Overview : Human CRCP (NP_055293, 1 a.a. - 148 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Form : Liquid
Molecular Mass : 19.0 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMEVKDANSALLSNYEVFQLLTDLKEQRKESGKNKHSSGQQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (20% glycerol, 1 mM dithiothreitol)
Gene Name CRCP CGRP receptor component [ Homo sapiens ]
Official Symbol CRCP
Synonyms CRCP; CGRP receptor component; DNA-directed RNA polymerase III subunit RPC9; calcitonin gene related peptide receptor component protein; CGRP RCP; RCP; RCP9; RNA polymerase III subunit C9; CGRP-receptor component protein; calcitonin gene-related peptide-receptor component protein; CGRPRCP; CGRP-RCP; MGC111194;
Gene ID 27297
mRNA Refseq NM_001040647
Protein Refseq NP_001035737
MIM 606121
UniProt ID O75575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRCP Products

Required fields are marked with *

My Review for All CRCP Products

Required fields are marked with *

0
cart-icon
0
compare icon