Recombinant Human CREBBP protein, His-tagged CREBBP-193H

Recombinant Human CREBBP protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CREBBP protein, His-tagged

Recombinant Human CREBBP protein, His-tagged

CREBBP Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CREBBP-193H
Product Overview : Recombinant Human CREBBP(a.a: 1081–1197) fused with His tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : His
Form : 45 mM Tris-HCl, pH 8.0, 124 mM NaCl, 2.4 mM KCl, and 10% glycerol
Molecular Mass : 14.9 kDa
AA Sequence : MHHHHHHRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQY QEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Purity : > 98%
Applications : Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Storage : >6 months at –80 centigrade. Avoid freeze/thaw cycles.
Concentration : 1.26 mg/ml
Gene Name : CREBBP CREB binding protein [ Homo sapiens ]
Official Symbol : CREBBP
Synonyms : CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS;
Gene ID : 1387
mRNA Refseq : NM_004380
Protein Refseq : NP_004371
MIM : 600140
UniProt ID : Q92793
Chromosome Location : 16p13.3
Pathway : Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Angiogenesis, organism-specific biosystem; BMAL1:CLOCK/NPAS2 Activates Circadian Expression, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell cycle, organism-specific biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy