"CRMP1" Related Products

Expand
Expand
Expand

Recombinant Human CRMP1 Protein, His-SUMO-tagged

Cat.No. : CRMP1-1172H
Product Overview : Recombinant Human CRMP1 Protein (1-572aa) was expressed in E. coli with N-terminal 6XHis-SUMO-tag.
Source : E. coli
Species : Human
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 78.2 kDa
AA Sequence : MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : CRMP1 collapsin response mediator protein 1 [ Homo sapiens ]
Official Symbol : CRMP1
Synonyms : CRMP1; collapsin response mediator protein 1; DRP1; DRP-1; DPYSL1; Dihydropyrimidinase-related protein 1;CRMP-1; dihydropyrimidinase related protein-1; dihydropyrimidinase-like 1
Gene ID : 1400
mRNA Refseq : NM_001014809
Protein Refseq : NP_001014809
MIM : 602462
UniProt ID : Q14194

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.