Recombinant Human CRTAP protein, His-tagged
Cat.No. : | CRTAP-4556H |
Product Overview : | Recombinant Human CRTAP protein(O75718)(27-401 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-401 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 50.9 kDa |
AASequence : | QYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | CRTAP cartilage associated protein [ Homo sapiens ] |
Official Symbol | CRTAP |
Synonyms | CRTAP; cartilage associated protein; cartilage-associated protein; CASP; leprecan like 3; LEPREL3; leprecan-like 3; OI7; |
Gene ID | 10491 |
mRNA Refseq | NM_006371 |
Protein Refseq | NP_006362 |
MIM | 605497 |
UniProt ID | O75718 |
◆ Recombinant Proteins | ||
CRTAP-11592H | Recombinant Human CRTAP, His-tagged | +Inquiry |
CRTAP-3926M | Recombinant Mouse CRTAP Protein | +Inquiry |
CRTAP-1034R | Recombinant Rhesus monkey CRTAP Protein, His-tagged | +Inquiry |
CRTAP-4556H | Recombinant Human CRTAP protein, His-tagged | +Inquiry |
Crtap-1666M | Recombinant Mouse Crtap protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTAP-7272HCL | Recombinant Human CRTAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRTAP Products
Required fields are marked with *
My Review for All CRTAP Products
Required fields are marked with *