Recombinant Human CSDE1, His-tagged
| Cat.No. : | CSDE1-28019TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 515-767 of Human CSDE1 Isoform 2 with N terminal His tag; Predicted MWt 29 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 515-767 a.a. | 
| Description : | RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 132 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | YSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSV NGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVE EGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQ NAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLF FHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVC EGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPR GPDNSMGFGAERKIRQAGVID | 
| Gene Name | CSDE1 cold shock domain containing E1, RNA-binding [ Homo sapiens ] | 
| Official Symbol | CSDE1 | 
| Synonyms | CSDE1; cold shock domain containing E1, RNA-binding; cold shock domain-containing protein E1; D1S155E; UNR; upstream of NRAS; | 
| Gene ID | 7812 | 
| mRNA Refseq | NM_001130523 | 
| Protein Refseq | NP_001123995 | 
| MIM | 191510 | 
| Uniprot ID | O75534 | 
| Chromosome Location | 1p13.2 | 
| Pathway | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; | 
| Function | DNA binding; RNA binding; | 
| ◆ Recombinant Proteins | ||
| CSDE1-2151HF | Recombinant Full Length Human CSDE1 Protein, GST-tagged | +Inquiry | 
| CSDE1-3642H | Recombinant Human VAMP8, GST-tagged | +Inquiry | 
| Csde1-2338M | Recombinant Mouse Csde1 Protein, Myc/DDK-tagged | +Inquiry | 
| CSDE1-1958H | Recombinant Human CSDE1 Protein, GST-tagged | +Inquiry | 
| CSDE1-7861Z | Recombinant Zebrafish CSDE1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CSDE1-7249HCL | Recombinant Human CSDE1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSDE1 Products
Required fields are marked with *
My Review for All CSDE1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            