Recombinant Human CSDE1, His-tagged
Cat.No. : | CSDE1-28019TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 515-767 of Human CSDE1 Isoform 2 with N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 515-767 a.a. |
Description : | RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 132 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSV NGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVE EGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQ NAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLF FHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVC EGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPR GPDNSMGFGAERKIRQAGVID |
Gene Name | CSDE1 cold shock domain containing E1, RNA-binding [ Homo sapiens ] |
Official Symbol | CSDE1 |
Synonyms | CSDE1; cold shock domain containing E1, RNA-binding; cold shock domain-containing protein E1; D1S155E; UNR; upstream of NRAS; |
Gene ID | 7812 |
mRNA Refseq | NM_001130523 |
Protein Refseq | NP_001123995 |
MIM | 191510 |
Uniprot ID | O75534 |
Chromosome Location | 1p13.2 |
Pathway | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; |
Function | DNA binding; RNA binding; |
◆ Recombinant Proteins | ||
Csde1-2338M | Recombinant Mouse Csde1 Protein, Myc/DDK-tagged | +Inquiry |
CSDE1-1627R | Recombinant Rat CSDE1 Protein | +Inquiry |
CSDE1-1285R | Recombinant Rat CSDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSDE1-1958H | Recombinant Human CSDE1 Protein, GST-tagged | +Inquiry |
CSDE1-3602H | Recombinant Human CSDE1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSDE1-7249HCL | Recombinant Human CSDE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSDE1 Products
Required fields are marked with *
My Review for All CSDE1 Products
Required fields are marked with *