Recombinant Human CSRP1 Protein, GST-tagged

• Cat.No.: CSRP1-2017H
• Product Overview: Human CSRP1 full-length ORF ( NP_004069.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
• Molecular Mass: 47 kDa
• AA Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
• Official Symbol: CSRP1
• Synonyms: CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E; LIM-domain protein; cysteine-rich protein 1; CRP; CRP1; DKFZp686M148
• Gene ID: 1465
• mRNA Refseq: NM_001193570
• Protein Refseq: NP_001180499
• MIM: 123876
• UniProt ID: P21291