Recombinant Human CST5 Protein, GST-tagged
Cat.No. : | CST5-2028H |
Product Overview : | Human CST5 full-length ORF ( NP_001891.2, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 42.5 kDa |
AA Sequence : | MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CST5 cystatin D [ Homo sapiens ] |
Official Symbol | CST5 |
Synonyms | CST5; cystatin D; cystatin-D; cystatin 5; cystatin-5; cysteine-proteinase inhibitor; MGC71922; |
Gene ID | 1473 |
mRNA Refseq | NM_001900 |
Protein Refseq | NP_001891 |
MIM | 123858 |
UniProt ID | P28325 |
◆ Recombinant Proteins | ||
CST5-102H | Recombinant Human CST5, His-tagged | +Inquiry |
CST5-675H | Recombinant Human CST5 protein, His-tagged | +Inquiry |
CST5-2238HF | Recombinant Full Length Human CST5 Protein, GST-tagged | +Inquiry |
CST5-494H | Active Recombinant Human CST5, His-tagged | +Inquiry |
CST5-1856H | Recombinant Human CST5 Protein (Gly21-Val142), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST5-3027HCL | Recombinant Human CST5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CST5 Products
Required fields are marked with *
My Review for All CST5 Products
Required fields are marked with *
0
Inquiry Basket