Recombinant Human CST9L protein, GST-tagged
| Cat.No. : | CST9L-301566H |
| Product Overview : | Recombinant Human CST9L protein(30-70 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 30-70 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | HFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CST9L cystatin 9-like [ Homo sapiens ] |
| Official Symbol | CST9L |
| Synonyms | CST9L; cystatin 9-like; cystatin 9 (mouse) like; cystatin-9-like; bA218C14.1; testatin; FLJ92394; |
| Gene ID | 128821 |
| mRNA Refseq | NM_080610 |
| Protein Refseq | NP_542177 |
| UniProt ID | Q9H4G1 |
| ◆ Recombinant Proteins | ||
| CST9L-2244HF | Recombinant Full Length Human CST9L Protein, GST-tagged | +Inquiry |
| CST9L-7353H | Recombinant Human CST9L protein, hFc-tagged | +Inquiry |
| CST9L-301566H | Recombinant Human CST9L protein, GST-tagged | +Inquiry |
| CST9L-948H | Recombinant Human CST9L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CST9L-2036H | Recombinant Human CST9L Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CST9L-1527HCL | Recombinant Human CST9L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST9L Products
Required fields are marked with *
My Review for All CST9L Products
Required fields are marked with *
