Recombinant Human CST9L protein, GST-tagged

• Cat.No.: CST9L-301566H
• Product Overview: Recombinant Human CST9L (30-70 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: His30-Leu70
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: HFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CST9L cystatin 9-like [ Homo sapiens ]
• Official Symbol: CST9L
• Synonyms: CST9L; cystatin 9-like; cystatin 9 (mouse) like; cystatin-9-like; bA218C14.1; testatin; FLJ92394
• Gene ID: 128821
• mRNA Refseq: NM_080610
• Protein Refseq: NP_542177
• UniProt ID: Q9H4G1