Recombinant Human CST9L protein, GST-tagged
Cat.No. : | CST9L-301566H |
Product Overview : | Recombinant Human CST9L (30-70 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | His30-Leu70 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | HFHEQRDCDEHNVMARYLPATVEFAVHTFNQQSKDYYAYRL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CST9L cystatin 9-like [ Homo sapiens ] |
Official Symbol | CST9L |
Synonyms | CST9L; cystatin 9-like; cystatin 9 (mouse) like; cystatin-9-like; bA218C14.1; testatin; FLJ92394; |
Gene ID | 128821 |
mRNA Refseq | NM_080610 |
Protein Refseq | NP_542177 |
UniProt ID | Q9H4G1 |
◆ Recombinant Proteins | ||
CST9L-948H | Recombinant Human CST9L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CST9L-301566H | Recombinant Human CST9L protein, GST-tagged | +Inquiry |
CST9L-7353H | Recombinant Human CST9L protein, hFc-tagged | +Inquiry |
CST9L-2036H | Recombinant Human CST9L Protein, GST-tagged | +Inquiry |
CST9L-2244HF | Recombinant Full Length Human CST9L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST9L-1527HCL | Recombinant Human CST9L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST9L Products
Required fields are marked with *
My Review for All CST9L Products
Required fields are marked with *