"CTF1" Related Products

Expand

Recombinant Human CTF1 protein

Cat.No.: CTF1-122H
Product Overview: Recombinant human CTF1 was expressed in E. coli.
Source: E. coli
Species: Human
Form: 1.0 mg/ml, sterile-filtered, in PBS Buffer, no any carrier protein.
Bio-activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml.
AA Sequence: SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAP SHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Endotoxin: < 1EU per 1 ug of protein by the LAL method
Purity: >95% by SDS-PAGE and visualized by silver stain.
Applications: 1. Active recombinant protein, may be used for its functional assay.2. As immunogen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: CTF1 cardiotrophin 1 [ Homo sapiens ]
Official Symbol: CTF1
Synonyms: CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1;
Gene ID: 1489
mRNA Refseq: NM_001142544
Protein Refseq: NP_001136016
MIM: 600435
UniProt ID: Q16619
Chromosome Location: 16p11.2
Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function: cytokine activity; leukemia inhibitory factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.