Active Recombinant Human CTF1 protein

• Cat.No.: CTF1-122H
• Product Overview: Recombinant human CTF1 was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Form: 1.0 mg/ml, sterile-filtered, in PBS Buffer, no any carrier protein.
• Bio-activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml.
• AA Sequence: SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAP SHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
• Endotoxin: < 1EU per 1 ug of protein by the LAL method
• Purity: >95% by SDS-PAGE and visualized by silver stain.
• Applications: 1. Active recombinant protein, may be used for its functional assay.2. As immunogen for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: CTF1 cardiotrophin 1 [ Homo sapiens ]
• Official Symbol: CTF1
• Synonyms: CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1
• Gene ID: 1489
• mRNA Refseq: NM_001142544
• Protein Refseq: NP_001136016
• MIM: 600435
• UniProt ID: Q16619
• Chromosome Location: 16p11.2
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: cytokine activity; leukemia inhibitory factor receptor binding