Cat.No.:	CTF1-122H
Product Overview:	Recombinant human CTF1 was expressed in E. coli.
Source:	E. coli
Species:	Human
Form:	1.0 mg/ml, sterile-filtered, in PBS Buffer, no any carrier protein.
Bio-activity:	Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml.
AA Sequence:	SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAP SHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Endotoxin:	< 1EU per 1 ug of protein by the LAL method
Purity:	>95% by SDS-PAGE and visualized by silver stain.
Applications:	1. Active recombinant protein, may be used for its functional assay.2. As immunogen for specific antibody production.
Storage:	Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Name:	CTF1 cardiotrophin 1 [ Homo sapiens ]
Official Symbol:	CTF1
Synonyms:	CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1;
Gene ID:	1489
mRNA Refseq:	NM_001142544
Protein Refseq:	NP_001136016
MIM:	600435
UniProt ID:	Q16619
Chromosome Location:	16p11.2
Pathway:	Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function:	cytokine activity; leukemia inhibitory factor receptor binding;

Online Inquiry