Recombinant Human CTH Protein

Cat.No. : CTH-929H
Product Overview : Recombinant Human CTH, transcript variant 1, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms.
Form : Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 44.7kD
AA Sequence : GHMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCY
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name CTH cystathionase (cystathionine gamma-lyase) [ Homo sapiens ]
Official Symbol CTH
Synonyms CTH; cystathionase (cystathionine gamma-lyase); cystathionine gamma-lyase; gamma-cystathionase; homoserine deaminase; cysteine desulfhydrase; homoserine dehydratase; cysteine-protein sulfhydrase; MGC9471;
Gene ID 1491
mRNA Refseq NM_001190463
Protein Refseq NP_001177392
MIM 607657
UniProt ID P32929

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTH Products

Required fields are marked with *

My Review for All CTH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon