Recombinant Human CTH Protein

Species :	Human
Source :	E.coli
Tag :	Non
Description :	This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms.
Form :	Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass :	44.7kD
AA Sequence :	GHMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCY
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining

Gene Name	CTH cystathionase (cystathionine gamma-lyase) [ Homo sapiens ]
Official Symbol	CTH
Synonyms	CTH; cystathionase (cystathionine gamma-lyase); cystathionine gamma-lyase; gamma-cystathionase; homoserine deaminase; cysteine desulfhydrase; homoserine dehydratase; cysteine-protein sulfhydrase; MGC9471;
Gene ID	1491
mRNA Refseq	NM_001190463
Protein Refseq	NP_001177392
MIM	607657
UniProt ID	P32929