Recombinant Human CTH Protein
Cat.No. : | CTH-929H |
Product Overview : | Recombinant Human CTH, transcript variant 1, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. |
Form : | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 44.7kD |
AA Sequence : | GHMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCY |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | CTH cystathionase (cystathionine gamma-lyase) [ Homo sapiens ] |
Official Symbol | CTH |
Synonyms | CTH; cystathionase (cystathionine gamma-lyase); cystathionine gamma-lyase; gamma-cystathionase; homoserine deaminase; cysteine desulfhydrase; homoserine dehydratase; cysteine-protein sulfhydrase; MGC9471; |
Gene ID | 1491 |
mRNA Refseq | NM_001190463 |
Protein Refseq | NP_001177392 |
MIM | 607657 |
UniProt ID | P32929 |
◆ Recombinant Proteins | ||
CTH-929H | Recombinant Human CTH Protein | +Inquiry |
Cth-7094R | Recombinant Rat Cth protein, His & GST-tagged | +Inquiry |
Cth-7093M | Recombinant Mouse Cth protein, His-tagged | +Inquiry |
CTH-1335H | Recombinant Human CTH, MYC/DDK-tagged | +Inquiry |
CTH-1288H | Recombinant Human CTH Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTH-7204HCL | Recombinant Human CTH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTH Products
Required fields are marked with *
My Review for All CTH Products
Required fields are marked with *