Recombinant Human CTRB1
| Cat.No. : | CTRB1-27445TH |
| Product Overview : | Recombinant fragment of Human CTRB1 with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC |
| Gene Name | CTRB1 chymotrypsinogen B1 [ Homo sapiens ] |
| Official Symbol | CTRB1 |
| Synonyms | CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B; |
| Gene ID | 1504 |
| mRNA Refseq | NM_001906 |
| Protein Refseq | NP_001897 |
| MIM | 118890 |
| Uniprot ID | P17538 |
| Chromosome Location | 16q23.1 |
| Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
| Function | peptidase activity; serine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| CTRB1-1165H | Recombinant Human CTRB1 protein, His & T7-tagged | +Inquiry |
| CTRB1-1084R | Recombinant Rhesus monkey CTRB1 Protein, His-tagged | +Inquiry |
| CTRB1-852H | Recombinant Human CTRB1 Protein, His-tagged | +Inquiry |
| CTRB1-909R | Recombinant Rhesus Macaque CTRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CTRB1-1319R | Recombinant Rat CTRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTRB1-7194HCL | Recombinant Human CTRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTRB1 Products
Required fields are marked with *
My Review for All CTRB1 Products
Required fields are marked with *
