Recombinant Human CTRB1
Cat.No. : | CTRB1-27445TH |
Product Overview : | Recombinant fragment of Human CTRB1 with N terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is one of a family of serine proteases that is secreted into the gastrointestinal tract as an inactive precursor, which is activated by proteolytic cleavage with trypsin. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMIC |
Gene Name | CTRB1 chymotrypsinogen B1 [ Homo sapiens ] |
Official Symbol | CTRB1 |
Synonyms | CTRB1; chymotrypsinogen B1; CTRB; chymotrypsinogen B; |
Gene ID | 1504 |
mRNA Refseq | NM_001906 |
Protein Refseq | NP_001897 |
MIM | 118890 |
Uniprot ID | P17538 |
Chromosome Location | 16q23.1 |
Pathway | Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; |
Function | peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
CTRB1-852H | Recombinant Human CTRB1 Protein, His-tagged | +Inquiry |
CTRB1-1319R | Recombinant Rat CTRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CTRB1-1165H | Recombinant Human CTRB1 protein, His & T7-tagged | +Inquiry |
CTRB1-853H | Recombinant Human CTRB1 Protein, GST-tagged | +Inquiry |
CTRB1-2323HF | Recombinant Full Length Human CTRB1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTRB1-7194HCL | Recombinant Human CTRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTRB1 Products
Required fields are marked with *
My Review for All CTRB1 Products
Required fields are marked with *
0
Inquiry Basket