Recombinant Human CUEDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CUEDC2-5282H
Product Overview : CUEDC2 MS Standard C13 and N15-labeled recombinant protein (NP_076945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.
Molecular Mass : 24.7 kDa
AA Sequence : MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CUEDC2 CUE domain containing 2 [ Homo sapiens (human) ]
Official Symbol CUEDC2
Synonyms CUEDC2; CUE domain containing 2; C10orf66; bA18I14.5; CUE domain-containing protein 2
Gene ID 79004
mRNA Refseq NM_024040
Protein Refseq NP_076945
MIM 614142
UniProt ID Q9H467

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CUEDC2 Products

Required fields are marked with *

My Review for All CUEDC2 Products

Required fields are marked with *

0
cart-icon
0
compare icon