Recombinant Human CUEDC2 Protein, GST-tagged
| Cat.No. : | CUEDC2-2126H | 
| Product Overview : | Human CUEDC2 full-length ORF ( NP_076945.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | CUEDC2 (CUE Domain Containing 2) is a Protein Coding gene. Among its related pathways are DNA Damage and Toll-like Receptor Signaling Pathway. | 
| Molecular Mass : | 51.1 kDa | 
| AA Sequence : | MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSA | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CUEDC2 CUE domain containing 2 [ Homo sapiens ] | 
| Official Symbol | CUEDC2 | 
| Synonyms | C10orf66; bA18I14.5 | 
| Gene ID | 79004 | 
| mRNA Refseq | NM_024040.2 | 
| Protein Refseq | NP_076945.2 | 
| MIM | 614142 | 
| UniProt ID | Q9H467 | 
| ◆ Recombinant Proteins | ||
| CUEDC2-2126H | Recombinant Human CUEDC2 Protein, GST-tagged | +Inquiry | 
| CUEDC2-4768C | Recombinant Chicken CUEDC2 | +Inquiry | 
| CUEDC2-4767C | Recombinant Chicken CUEDC2 | +Inquiry | 
| CUEDC2-1336R | Recombinant Rat CUEDC2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CUEDC2-1677R | Recombinant Rat CUEDC2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CUEDC2-7186HCL | Recombinant Human CUEDC2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUEDC2 Products
Required fields are marked with *
My Review for All CUEDC2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            