Recombinant Human CUTA Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CUTA-4849H |
| Product Overview : | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). |
| Molecular Mass : | 16.8 kDa |
| AA Sequence : | MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CUTA cutA divalent cation tolerance homolog [ Homo sapiens (human) ] |
| Official Symbol | CUTA |
| Synonyms | CUTA; cutA divalent cation tolerance homolog (E. coli); acetylcholinesterase associated protein, ACHAP, C6orf82, chromosome 6 open reading frame 82; protein CutA; divalent cation tolerant protein CUTA; acetylcholinesterase-associated protein; brain acetylcholinesterase putative membrane anchor; ACHAP; C6orf82; MGC111154; |
| Gene ID | 51596 |
| mRNA Refseq | NM_001014837 |
| Protein Refseq | NP_001014837 |
| MIM | 616953 |
| UniProt ID | O60888 |
| ◆ Recombinant Proteins | ||
| CUTA-1338R | Recombinant Rat CUTA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CUTA-5384B | Recombinant Bovine CUTA protein, Avi-tagged, Biotinylated | +Inquiry |
| Cuta-2380M | Recombinant Mouse Cuta Protein, Myc/DDK-tagged | +Inquiry |
| CUTA-2367H | Recombinant Human CUTA, His-tagged | +Inquiry |
| CUTA-5905H | Recombinant Human CUTA Protein (Met1-Pro156), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CUTA-7177HCL | Recombinant Human CUTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUTA Products
Required fields are marked with *
My Review for All CUTA Products
Required fields are marked with *
