Recombinant Human CUTA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CUTA-4849H
Product Overview : CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
Molecular Mass : 16.8 kDa
AA Sequence : MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CUTA cutA divalent cation tolerance homolog [ Homo sapiens (human) ]
Official Symbol CUTA
Synonyms CUTA; cutA divalent cation tolerance homolog (E. coli); acetylcholinesterase associated protein, ACHAP, C6orf82, chromosome 6 open reading frame 82; protein CutA; divalent cation tolerant protein CUTA; acetylcholinesterase-associated protein; brain acetylcholinesterase putative membrane anchor; ACHAP; C6orf82; MGC111154;
Gene ID 51596
mRNA Refseq NM_001014837
Protein Refseq NP_001014837
MIM 616953
UniProt ID O60888

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CUTA Products

Required fields are marked with *

My Review for All CUTA Products

Required fields are marked with *

0
cart-icon
0
compare icon