Recombinant Human CUTA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CUTA-5791H
• Product Overview: CUTA MS Standard C13 and N15-labeled recombinant protein (NP_057005) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
• Molecular Mass: 16.7 kDa
• AA Sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVHQVTESVSDSITVLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CUTA cutA divalent cation tolerance homolog [ Homo sapiens (human) ]
• Official Symbol: CUTA
• Synonyms: CUTA; cutA divalent cation tolerance homolog (E. coli); acetylcholinesterase associated protein, ACHAP, C6orf82, chromosome 6 open reading frame 82; protein CutA; divalent cation tolerant protein CUTA; acetylcholinesterase-associated protein; brain acetylcholinesterase putative membrane anchor; ACHAP; C6orf82; MGC111154
• Gene ID: 51596
• mRNA Refseq: NM_015921
• Protein Refseq: NP_057005
• MIM: 616953
• UniProt ID: O60888