Recombinant Human CYP17A1 protein, His-tagged

Cat.No. : CYP17A1-3622H
Product Overview : Recombinant Human CYP17A1 protein(160-508 aa), fused to His tag, was expressed in E. coli.
Availability July 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 160-508 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CYP17A1 cytochrome P450, family 17, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP17A1
Synonyms CYP17A1; cytochrome P450, family 17, subfamily A, polypeptide 1; CYP17, cytochrome P450, subfamily XVII (steroid 17 alpha hydroxylase), adrenal hyperplasia; steroid 17-alpha-hydroxylase/17,20 lyase; CPT7; P450C17; S17AH; Steroid 17 alpha monooxygenase; CYPXVII; cytochrome P450c17; cytochrome P450-C17; cytochrome P450 17A1; cytochrome p450 XVIIA1; steroid 17-alpha-monooxygenase; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; CYP17;
Gene ID 1586
mRNA Refseq NM_000102
Protein Refseq NP_000093
MIM 609300
UniProt ID P05093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP17A1 Products

Required fields are marked with *

My Review for All CYP17A1 Products

Required fields are marked with *

0
cart-icon