"CYP2J2" Related Products

Recombinant Human CYP2J2 Protein, GST-tagged

Cat.No. : CYP2J2-2268H
Product Overview : Human CYP2J2 partial ORF ( NP_000766, 408 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 35.75 kDa
AA Sequence : LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CYP2J2 cytochrome P450, family 2, subfamily J, polypeptide 2 [ Homo sapiens ]
Official Symbol : CYP2J2
Synonyms : CYP2J2; cytochrome P450, family 2, subfamily J, polypeptide 2; cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2; cytochrome P450 2J2; CYPIIJ2; microsomal monooxygenase; arachidonic acid epoxygenase; flavoprotein-linked monooxygenase; CPJ2;
Gene ID : 1573
mRNA Refseq : NM_000775
Protein Refseq : NP_000766
MIM : 601258
UniProt ID : P51589

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.