Recombinant Human CYP2J2 Protein, GST-tagged

Cat.No. : CYP2J2-2268H
Product Overview : Human CYP2J2 partial ORF ( NP_000766, 408 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016]
Molecular Mass : 35.75 kDa
AA Sequence : LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYP2J2 cytochrome P450, family 2, subfamily J, polypeptide 2 [ Homo sapiens ]
Official Symbol CYP2J2
Synonyms CYP2J2; cytochrome P450, family 2, subfamily J, polypeptide 2; cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2; cytochrome P450 2J2; CYPIIJ2; microsomal monooxygenase; arachidonic acid epoxygenase; flavoprotein-linked monooxygenase; CPJ2;
Gene ID 1573
mRNA Refseq NM_000775
Protein Refseq NP_000766
MIM 601258
UniProt ID P51589

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP2J2 Products

Required fields are marked with *

My Review for All CYP2J2 Products

Required fields are marked with *

0
cart-icon