Recombinant Human CYP2J2 Protein, GST-tagged
| Cat.No. : | CYP2J2-2268H |
| Product Overview : | Human CYP2J2 partial ORF ( NP_000766, 408 a.a. - 498 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is thought to be the predominant enzyme responsible for epoxidation of endogenous arachidonic acid in cardiac tissue. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016] |
| Molecular Mass : | 35.75 kDa |
| AA Sequence : | LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CYP2J2 cytochrome P450, family 2, subfamily J, polypeptide 2 [ Homo sapiens ] |
| Official Symbol | CYP2J2 |
| Synonyms | CYP2J2; cytochrome P450, family 2, subfamily J, polypeptide 2; cytochrome P450, subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2; cytochrome P450 2J2; CYPIIJ2; microsomal monooxygenase; arachidonic acid epoxygenase; flavoprotein-linked monooxygenase; CPJ2; |
| Gene ID | 1573 |
| mRNA Refseq | NM_000775 |
| Protein Refseq | NP_000766 |
| MIM | 601258 |
| UniProt ID | P51589 |
| ◆ Recombinant Proteins | ||
| CYP2J2-80H | Recombinant Human CYP2J2 Protein | +Inquiry |
| CYP2J2-2268H | Recombinant Human CYP2J2 Protein, GST-tagged | +Inquiry |
| CYP2J2-47H | Active Recombinant Human CYP2J2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CYP2J2-7110HCL | Recombinant Human CYP2J2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP2J2 Products
Required fields are marked with *
My Review for All CYP2J2 Products
Required fields are marked with *
