| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Cystatin C is a non-glycosylated cysteine protease inhibitor, which is produced by all nucleated cells. The concentration of serum cystatin C correlates with glomerular filtration rate (GFR), and cystatin C is used as a biomarker for kidney function. |
| Form : |
Lyophilized |
| Bio-activity : |
Not applicable (N/A) |
| Molecular Mass : |
16 kDa |
| AA Sequence : |
MGSSHHHHHHSSGLVPRGSHMSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGT MTLSKSTCQDA |
| Storage : |
2–8centigrade |
| Concentration : |
0.5 mg/ml when reconstituted with 200 µl of deionized water |
| Storage Buffer : |
50 mM Tris-HCl, pH 7.5, 150 mM NaCl; containing 6 % sucrose as a stabilizer |
| Reconstitution : |
Reconstitute the lyophilized protein with 200 µl of deionized water |
