"GST1" Related Products

Recombinant Human cystatin C Protein

Cat.No. : GST1-1025H
Product Overview : Recombinant Human cystatin C antigen with an N-terminal histidine tag. Predicted molecular weight: 16 kDa
Description : Cystatin C is a non-glycosylated cysteine protease inhibitor, which is produced by all nucleated cells. The concentration of serum cystatin C correlates with glomerular filtration rate (GFR), and cystatin C is used as a biomarker for kidney function.
Source : E. coli
Species : Human
Tag : His
Form : Lyophilized
Bio-activity : Not applicable (N/A)
Molecular Mass : 16 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGT MTLSKSTCQDA
Storage : 2–8centigrade
Concentration : 0.5 mg/ml when reconstituted with 200 µl of deionized water
Storage Buffer : 50 mM Tris-HCl, pH 7.5, 150 mM NaCl; containing 6 % sucrose as a stabilizer
Reconstitution : Reconstitute the lyophilized protein with 200 µl of deionized water
Official Symbol : GST1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.