"DCN" Related Products

Expand
Expand

Recombinant Human DCN protein, T7/His-tagged

Cat.No.: DCN-82H
Product Overview: Recombinant human decorin extracellular domain cDNA (31-359 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQG^GEFEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVP KDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKT LQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTEL HLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHN NNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Purity: >90% by SDS-PAGE
Applications: 1. May be used as coating matrix protein for human cell functional and differentiation regulation study in vitro,2. May be used as potential biomarker for lung cancer diagnostic development.3. May be used for specific antibody production.
Storage: Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: DCN decorin [ Homo sapiens ]
Official Symbol: DCN
Synonyms: DCN; decorin; decorin proteoglycan; DSPG2; SLRR1B; PG-S2; bone proteoglycan II; proteoglycan core protein; small leucine-rich protein 1B; dermatan sulphate proteoglycans II; CSCD; PG40; PGII; PGS2;
Gene ID: 1634
mRNA Refseq: NM_001920
Protein Refseq: NP_001911
MIM: 125255
UniProt ID: P07585
Chromosome Location: 12q23
Pathway: TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; Validated transcriptional targets of AP1 family members Fra1 and Fra2, organism-specific biosystem;
Function: collagen binding; extracellular matrix binding; glycosaminoglycan binding; protein N-terminus binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.