Recombinant Human DEFB4A protein, GST-tagged
Cat.No. : | DEFB4A-2815H |
Product Overview : | Recombinant Human DEFB4A protein(O15263)(1-64aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-64aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.3 kDa |
AA Sequence : | MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DEFB4A defensin, beta 4A [ Homo sapiens ] |
Official Symbol | DEFB4A |
Synonyms | DEFB4A; defensin, beta 4A; DEFB2, DEFB4, DEFB102, defensin, beta 2 , defensin, beta 4; beta-defensin 4A; DEFB 2; HBD 2; SAP1; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1; BD-2; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; |
Gene ID | 1673 |
mRNA Refseq | NM_004942 |
Protein Refseq | NP_004933 |
MIM | 602215 |
UniProt ID | O15263 |
◆ Recombinant Proteins | ||
DEFB4A-5133H | Recombinant Human DEFB4A Protein, GST-tagged | +Inquiry |
DEFB4A-1239R | Recombinant Rhesus monkey DEFB4A Protein, His-tagged | +Inquiry |
DEFB4A-632H | Recombinant Human DEFB4A protein, His & GST-tagged | +Inquiry |
DEFB4A -5387H | Recombinant Human Defensin, Beta 4A | +Inquiry |
DEFB4A-2815H | Recombinant Human DEFB4A protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DEFB4A Products
Required fields are marked with *
My Review for All DEFB4A Products
Required fields are marked with *