Recombinant Human DEFB4A protein, GST-tagged

Cat.No. : DEFB4A-2815H
Product Overview : Recombinant Human DEFB4A protein(O15263)(1-64aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-64aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.3 kDa
AA Sequence : MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKC CKKP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DEFB4A defensin, beta 4A [ Homo sapiens ]
Official Symbol DEFB4A
Synonyms DEFB4A; defensin, beta 4A; DEFB2, DEFB4, DEFB102, defensin, beta 2 , defensin, beta 4; beta-defensin 4A; DEFB 2; HBD 2; SAP1; defensin, beta 2; defensin, beta 4; skin-antimicrobial peptide 1; BD-2; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102;
Gene ID 1673
mRNA Refseq NM_004942
Protein Refseq NP_004933
MIM 602215
UniProt ID O15263

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DEFB4A Products

Required fields are marked with *

My Review for All DEFB4A Products

Required fields are marked with *

0
cart-icon